Antibody data

Product number
ABIN784709
Provider
antibodies-online
Product name
anti-Nuclear Receptor Subfamily 3, Group C, Member 1 (Glucocorticoid Receptor) (NR3C1) (N-Term) antibody
Provider product page
antibodies-online - ABIN784709
Antibody type
Polyclonal
Antigen
The immunogen for anti-NR3C1 antibody: synthetic peptide directed towards the N terminal of human NR3C1
Reactivity
Human
Host
Rabbit
Antigen sequence
MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRG
GATVK VSASSPSLAV
Vial size
50 µg
Provider Type Product Number
- No reagents -