HPA004248

NR3C1 antibody from Atlas Antibodies
GR, GRL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004248
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004248, RRID:AB_1078976
Product name
Anti-NR3C1
Provider product page
Atlas Antibodies - HPA004248
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGG
ATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVS
NAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQ
QGQISLSSGETDLKLLEESIANLNRSTSVPENPKS
SASTAVSA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -