HPA004248

NR3C1 antibody from Sigma-Aldrich
GR, GRL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004248
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004248, RRID:AB_1078976
Product name
Anti-NR3C1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004248
Antibody type
Polyclonal
Antigen
Glucocorticoid receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSKESLTPGREENPSSVLAQERGDVMDFYKTLRGG
ATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVS
NAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQ
QGQISLSSGETDLKLLEESIANLNRSTSVPENPKS
SASTAVSA
Storage
-20C
Provider Type Product Number
- No reagents -