HPA022901

MPRIP antibody from Sigma-Aldrich
M-RIP, p116Rip, RHOIP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022901
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022901, RRID:AB_2297761
Product name
Anti-MPRIP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022901
Antibody type
Polyclonal
Antigen
Myosin phosphatase Rho-interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KDAYELEVLLRVKESEIQYLKQEISSLKDELQTAL
RDKKYASDKYKDIYTELSIAKAKADCDISRLKEQL
KAATEALGEKSPDSATVSGYDIMKSKSNPDFLKKD
RSCVTRQL
Storage
-20C
Provider Type Product Number
- No reagents -