HPA020949

ZMYND8 antibody from Sigma-Aldrich
PRKCBP1, RACK7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020949
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020949, RRID:AB_1857223
Product name
Anti-ZMYND8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020949
Antibody type
Polyclonal
Antigen
Protein kinase C-binding protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQ
QQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLG
INEISEDVYTAVEHSDSEDSEKSDSSDSEYISDDE
QKSKN
Storage
-20C
Provider Type Product Number
- No reagents -