HPA020620

TUT7 antibody from MilliporeSigma / Merck KGaA
FLJ13409, KIAA1711, PAPD6, TENT3B, ZCCHC6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020620
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA020620, RRID:AB_1858984
Product name
Anti-ZCCHC6 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA020620
Antibody type
Polyclonal
Antigen
Zinc finger CCHC domain-containing protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDYKGDKVYHPETGRKNEKEKVGRKGKHLLTVDQK
RGEHVVCGSTRNNESESTLDLEGFQNPTAKECEGL
ATLDNKADLDGESTEGTEELEDSLNHFTHSVQGQ
Storage
-20C
Provider Type Product Number
- No reagents -