HPA004155

NOVA1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004155
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004155, RRID:AB_1079497
Product name
Anti-NOVA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004155
Antibody type
Polyclonal
Antigen
RNA-binding protein Nova-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLNTLGLGLSQAAATGALAAAAASANPAAAAANLL
ATYASEASASGSTAGGTAGTFALGSLAAATAATNG
YFGAASPLAASAILGTEKSTDGSKDVVEIAVPENL
VGAILGKGGKTLVEYQELTGARI
Storage
-20C
Provider Type Product Number
- No reagents -