HPA019539

FAM174A antibody from Atlas Antibodies
NS5ATP6, TMEM157, UNQ1912
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019539
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019539, RRID:AB_2293743
Product name
Anti-FAM174A
Provider product page
Atlas Antibodies - HPA019539
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTL
FDANHPRR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -