HPA019539

FAM174A antibody from Sigma-Aldrich
TMEM157, UNQ1912
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019539
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019539, RRID:AB_2293743
Product name
Anti-FAM174A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019539
Antibody type
Polyclonal
Antigen
Membrane protein FAM174A Precursor (Transmembrane protein 157) (Hepatitis C virus NS5A-transactivated protein 6) (HCV NS5A-transactivated protein 6)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTL
FDANHPRR
Storage
-20C
Provider Type Product Number
- No reagents -