HPA004141

ACSS2 antibody from Sigma-Aldrich
ACAS2, AceCS, ACS, ACSA, dJ1161H23.1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004141
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004141, RRID:AB_1078094
Product name
Anti-ACSS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004141
Antibody type
Polyclonal
Antigen
Acetyl-coenzyme A synthetase, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVA
IYMPMIPELVVAMLACARIGALHSIVFAGFSSESL
CERILDSSCSLLITTDAFYRGEKLVNLKELADEAL
QKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPP
IKRSCPDVQ
Storage
-20C
Provider Type Product Number
- No reagents -