Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183154 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Potassium Channel, Subfamily K, Member 10 (KCNK10) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNK10 antibody: synthetic peptide directed towards the C terminal of human KCNK10
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Canine, Rabbit
- Host
- Rabbit
- Antigen sequence
EDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSST
AMLTD CIQQHAELEN- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Expression pattern and functional characteristics of two novel splice variants of the two-pore-domain potassium channel TREK-2.
Gu W, Schlichthörl G, Hirsch JR, Engels H, Karschin C, Karschin A, Derst C, Steinlein OK, Daut J
The Journal of physiology 2002 Mar 15;539(Pt 3):657-68
The Journal of physiology 2002 Mar 15;539(Pt 3):657-68
No comments: Submit comment
No validations: Submit validation data