HPA021997

COPS3 antibody from Sigma-Aldrich
CSN3, SGN3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021997
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021997, RRID:AB_1847152
Product name
Anti-COPS3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021997
Antibody type
Polyclonal
Antigen
COP9 signalosome complex subunit 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KYVLHMIEDGEIFASINQKDGMVSFHDNPEKYNNP
AMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQ
KSMGSQEDDSGNKPSSYS
Storage
-20C
Provider Type Product Number
- No reagents -