Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN486918 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 25 (ZNF25) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF25 antibody: synthetic peptide directed towards the middle region of human ZNF25
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
SFSQKSHFIIHQRKHTGEKPYECQECGETFIQKSQ
LTAHQ KTHTKKRNAE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genomic sequence and transcriptional profile of the boundary between pericentromeric satellites and genes on human chromosome arm 10q.
Guy J, Spalluto C, McMurray A, Hearn T, Crosier M, Viggiano L, Miolla V, Archidiacono N, Rocchi M, Scott C, Lee PA, Sulston J, Rogers J, Bentley D, Jackson MS
Human molecular genetics 2000 Aug 12;9(13):2029-42
Human molecular genetics 2000 Aug 12;9(13):2029-42
No comments: Submit comment
No validations: Submit validation data