Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183847 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 25 (ZNF25) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF25 antibody: synthetic peptide directed towards the C terminal of human ZNF25
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
EKPYACKECGKSFSQKSHFIIHQRKHTGEKPYECQ
ECGET FIQKSQLTAH- Epitope
- C-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Duplicated KOX zinc finger gene clusters flank the centromere of human chromosome 10: evidence for a pericentric inversion during primate evolution.
Tunnacliffe A, Liu L, Moore JK, Leversha MA, Jackson MS, Papi L, Ferguson-Smith MA, Thiesen HJ, Ponder BA
Nucleic acids research 1993 Mar 25;21(6):1409-17
Nucleic acids research 1993 Mar 25;21(6):1409-17
No comments: Submit comment
No validations: Submit validation data