Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310558 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLCO6A1 antibody: synthetic peptide directed towards the N terminal of human SLCO6A1
- Description
- Protein A purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQK
EYQLK TIEKLALEKS- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification and characterization of novel rat and human gonad-specific organic anion transporters.
Suzuki T, Onogawa T, Asano N, Mizutamari H, Mikkaichi T, Tanemoto M, Abe M, Satoh F, Unno M, Nunoki K, Suzuki M, Hishinuma T, Goto J, Shimosegawa T, Matsuno S, Ito S, Abe T
Molecular endocrinology (Baltimore, Md.) 2003 Jul;17(7):1203-15
Molecular endocrinology (Baltimore, Md.) 2003 Jul;17(7):1203-15
No comments: Submit comment
No validations: Submit validation data