Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AV44138 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-SLCO6A1 (AB1) antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- synthetic peptide corresponding to a region of human SLCO6A1 with an internal ID of P25582
- Description
- IgG fraction of antiserum
- Reactivity
- Human
- Antigen sequence
FMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTI
EKLALEKSYDISSGL- Storage
- -20C
No comments: Submit comment
No validations: Submit validation data