Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006374-M05 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006374-M05, RRID:AB_463922
- Product name
- CXCL5 monoclonal antibody (M05), clone 2A9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CXCL5.
- Antigen sequence
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIA
SAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA
IGPQCSKVEVVASLKNGKEICLDPEAPFLRKVIQK
ILDGGNKEN- Isotype
- IgG
- Antibody clone number
- 2A9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references CXCL5 contributes to tumor metastasis and recurrence of intrahepatic cholangiocarcinoma by recruiting infiltrative intratumoral neutrophils.
CXCL5 knockdown expression inhibits human bladder cancer T24 cells proliferation and migration.
Overexpression of CXCL5 mediates neutrophil infiltration and indicates poor prognosis for hepatocellular carcinoma.
Zhou SL, Dai Z, Zhou ZJ, Chen Q, Wang Z, Xiao YS, Hu ZQ, Huang XY, Yang GH, Shi YH, Qiu SJ, Fan J, Zhou J
Carcinogenesis 2014 Mar;35(3):597-605
Carcinogenesis 2014 Mar;35(3):597-605
CXCL5 knockdown expression inhibits human bladder cancer T24 cells proliferation and migration.
Zheng J, Zhu X, Zhang J
Biochemical and biophysical research communications 2014 Mar 28;446(1):18-24
Biochemical and biophysical research communications 2014 Mar 28;446(1):18-24
Overexpression of CXCL5 mediates neutrophil infiltration and indicates poor prognosis for hepatocellular carcinoma.
Zhou SL, Dai Z, Zhou ZJ, Wang XY, Yang GH, Wang Z, Huang XW, Fan J, Zhou J
Hepatology (Baltimore, Md.) 2012 Dec;56(6):2242-54
Hepatology (Baltimore, Md.) 2012 Dec;56(6):2242-54
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CXCL5 expression in transfected 293T cell line by CXCL5 monoclonal antibody (M05), clone 2A9.Lane 1: CXCL5 transfected lysate(12 KDa).Lane 2: Non-transfected lysate.
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CXCL5 on formalin-fixed paraffin-embedded human smooth muscle. [antibody concentration 0.7 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol