HPA008001

LRPAP1 antibody from Sigma-Aldrich
A2MRAP, HBP44, RAP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008001
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008001, RRID:AB_1853292
Product name
Anti-LRPAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008001
Antibody type
Polyclonal
Antigen
Alpha-2-macroglobulin receptor-associated protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERD
ELAWKKLKLDGLDEDGEKEARLIRNLNVILAKYGL
DGKKDARQVTSNSLSGTQEDGLDDPRLEKLWHKAK
TSGKFSGEELDKLWREFLHHKEK
Storage
-20C
Provider Type Product Number
- No reagents -