Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502468 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 25, Member 32 (SLC25A32) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC25A32 antibody: synthetic peptide directed towards the middle region of human SLC25A32
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
NRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVR
ARLQD QHMFYSGVID- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Retrovirally mediated complementation of the glyB phenotype. Cloning of a human gene encoding the carrier for entry of folates into mitochondria.
Titus SA, Moran RG
The Journal of biological chemistry 2000 Nov 24;275(47):36811-7
The Journal of biological chemistry 2000 Nov 24;275(47):36811-7
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting