Antibody data

Product number
ABIN310542
Provider
antibodies-online
Product name
anti-Solute Carrier Family 25, Member 32 (SLC25A32) (N-Term) antibody
Provider product page
antibodies-online - ABIN310542
Antibody type
Polyclonal
Antigen
The immunogen for anti-SLC25A32 antibody: synthetic peptide directed towards the N terminal of human SLC25A32
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDG
LELRP KYNGILHCLT
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -