AV44049

SLC25A32 antibody from MilliporeSigma / Merck KGaA
MFTC
No application information provided.

Antibody data

Product number
AV44049
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-SLC25A32 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV44049
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human SLC25A32 with an internal ID of P11790
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT
TIWKLDGLRGLYQGV
Storage
-20C