WH0006642M1

SNX1 antibody from Sigma-Aldrich
HsT17379, MGC8664, SNX1A, Vps5
ELISA
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0006642M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0006642M1, RRID:AB_1843693
Product name
Monoclonal Anti-SNX1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0006642M1
Antibody type
Monoclonal
Antigen
SNX1 (NP_003090, a.a. 166-276) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
KVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEK
HSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFL
EKRRAALERYLQRIVNHPTMLQDPDVREFLEKEEL
PRAVG* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -