H00006642-A01

SNX1 antibody from Abnova Corporation
HsT17379, MGC8664, SNX1A, Vps5
No application information provided.

Antibody data

Product number
H00006642-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006642-A01, RRID:AB_462422
Product name
SNX1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00006642-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant SNX1.
Antigen sequence
KVTTQTSLPLFRSKQFAVKRRFSDFLGLYEKLSEK
HSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFL
EKRRAALERYLQRIVNHPTMLQDPDVREFLEKEEL
PRAVG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -