H00006642-B01

SNX1 antibody from Abnova Corporation
HsT17379, MGC8664, SNX1A, Vps5

Antibody data

Product number
H00006642-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006642-B01, RRID:AB_939477
Product name
SNX1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00006642-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SNX1 protein.
Antigen sequence
MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPE
AGDSDTEGEDIFTGAAVVSKHQSPKITTSLLPINN
GSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQ
KKVLAKTLISLPPQEATNSSKPQPTYEELEEEEQE
DQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPL
FRSKQFAVKRRFSDFLGLYEKLSEKHSQNGFIVPP
PPEKSLIGMTKVKVGKEDSSSAEFLEKRRAALERY
LQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLS
GAGLLKMFNKATDAVSKMTIKMNESDIWFEEKLQE
VECEEQRLRKLHAVVETLVNHRKELALNTAQFAKS
LAMLGSSEDNTALSRALSQLAEVEEKIEQLHQEQA
NNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW
QDAQATLQKKREAEARLLWANKPDKLQQAKDEILE
WESRVTQYERDFERISTVVRKEVIRFEKEKSKDFK
NHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -