Antibody data

Product number
PAB21463
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21463, RRID:AB_10983319
Product name
FLJ45537 polyclonal antibody
Provider product page
Abnova Corporation - PAB21463
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human FLJ45537.
Reactivity
Human
Host
Rabbit
Antigen sequence
TLTNTVEDIQIDNFRRKSDLGVGSPDWKNLLIDVT
REDHENSQNNSKRRCKVNCETDQR
Isotype
IgG
Vial size
100 uL
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -