HPA021912

C9orf170 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021912
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021912, RRID:AB_1848946
Product name
Anti-C9orf170 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021912
Antibody type
Polyclonal
Antigen
Putative uncharacterized protein FLJ45537 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLTNTVEDIQIDNFRRKSDLGVGSPDWKNLLIDVT
REDHENSQNNSKRRCKVNCETDQR
Storage
-20C
Provider Type Product Number
- No reagents -