HPA004184

LIMCH1 antibody from Atlas Antibodies
DKFZP686A01247, LIMCH1A, LMO7B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004184
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004184, RRID:AB_1078673
Product name
Anti-LIMCH1
Provider product page
Atlas Antibodies - HPA004184
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HTEEVKLIVTCNMRAQESEPVEGGLRKVPDLHKDD
LAQQRIQGSLAPHREPPSFITLSNITEADLETWER
LKVSEKARDGDVQHICASEPSPEIKAETAIRDDFA
NRKARASKKASSPRQKFVHFGPVTELDQQKW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -