HPA004184

LIMCH1 antibody from Sigma-Aldrich
DKFZP686A01247, LIMCH1A, LMO7B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004184
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004184, RRID:AB_1078673
Product name
Anti-LIMCH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004184
Antibody type
Polyclonal
Antigen
LIM and calponin homology domains-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HTEEVKLIVTCNMRAQESEPVEGGLRKVPDLHKDD
LAQQRIQGSLAPHREPPSFITLSNITEADLETWER
LKVSEKARDGDVQHICASEPSPEIKAETAIRDDFA
NRKARASKKASSPRQKFVHFGPVTELDQQKW
Storage
-20C
Provider Type Product Number
- No reagents -