HPA024785

DPYS antibody from Atlas Antibodies
DHPase
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024785
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024785, RRID:AB_1847856
Product name
Anti-DPYS
Provider product page
Atlas Antibodies - HPA024785
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYK
RIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDA
TAG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -