Antibody data
- Product number
- HPA006347
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA006347, RRID:AB_2181208
- Product name
- Anti-RBM47
- Provider product page
- Atlas Antibodies - HPA006347
- Antibody type
- Polyclonal
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKA
ARGGGAAEAAQQPSYVYSCDPYTLAYYGYPYNALI
GPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGG
YSAGRGIYSRYHEGKGKQQEKGYELVPNLEIPTVN
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line BEWO.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Western blot analysis in human cell lines A-549 and SK-MEL-30 using Anti-RBM47 antibody. Corresponding RBM47 RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human stomach shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human endometrium shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human stomach and endometrium tissues using Anti-RBM47 antibody. Corresponding RBM47 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more