Antibody data

Product number
HPA006347
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA006347, RRID:AB_2181208
Product name
Anti-RBM47
Provider product page
Atlas Antibodies - HPA006347
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKA
ARGGGAAEAAQQPSYVYSCDPYTLAYYGYPYNALI
GPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGG
YSAGRGIYSRYHEGKGKQQEKGYELVPNLEIPTVN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.