HPA006347

RBM47 antibody from Sigma-Aldrich
FLJ20273, NET18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006347
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006347, RRID:AB_2181208
Product name
Anti-RBM47 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006347
Antibody type
Polyclonal
Antigen
RNA-binding protein 47 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKA
ARGGGAAEAAQQPSYVYSCDPYTLAYYGYPYNALI
GPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGG
YSAGRGIYSRYHEGKGKQQEKGYELVPNLEIPTVN
Storage
-20C
Provider Type Product Number
- No reagents -