PAB21820

KCNK3 antibody from Abnova Corporation
K2p3.1, TASK, TASK-1

Antibody data

Product number
PAB21820
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21820, RRID:AB_10962528
Product name
KCNK3 polyclonal antibody
Provider product page
Abnova Corporation - PAB21820
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human KCNK3.
Reactivity
Human
Host
Rabbit
Antigen sequence
AVFDALESEPELIERQRLELRQQELRARYNLSQGG
YEELERVVLRLKPHKAGVQ
Isotype
IgG
Vial size
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -