AV35090

KCNK3 antibody from Sigma-Aldrich
K2p3.1, TASK, TASK-1
No application information provided.

Antibody data

Product number
AV35090
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV35090, RRID:AB_1855565
Product name
Anti-KCNK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV35090
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human KCNK3 with an internal ID of P08952
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
SIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPS
RRCLCSGAPRSAISS
Storage
-20C
Provider Type Product Number
- No reagents -