HPA026658

KCNK3 antibody from Sigma-Aldrich
K2p3.1, TASK, TASK-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026658
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026658, RRID:AB_1855566
Product name
Anti-KCNK3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026658
Antibody type
Polyclonal
Antigen
Potassium channel subfamily K member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVFDALESEPELIERQRLELRQQELRARYNLSQGG
YEELERVVLRLKPHKAGVQ
Storage
-20C
Provider Type Product Number
- No reagents -