Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183518 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Casein Kinase 1, gamma 1 (CSNK1G1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CSNK1G1 antibody: synthetic peptide directed towards the middle region of mouse CSNK1G1
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
CENFPEEMATYLRYVRRLDFFEKPDYEYLRTLFTD
LFERK GYTFDYAYDW- Epitope
- Middle Region
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Physiological role for casein kinase 1 in glutamatergic synaptic transmission.
Chergui K, Svenningsson P, Greengard P
The Journal of neuroscience : the official journal of the Society for Neuroscience 2005 Jul 13;25(28):6601-9
The Journal of neuroscience : the official journal of the Society for Neuroscience 2005 Jul 13;25(28):6601-9
No comments: Submit comment
No validations: Submit validation data