Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109558 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 30 (Zinc Transporter), Member 9 (SLC30A9) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC30A9 antibody: synthetic peptide directed towards the N terminal of human SLC30A9
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAI
NEFCLKSSDLEQLR- Epitope
- N-Term
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references The novel human HUEL (C4orf1) protein shares homology with the DNA-binding domain of the XPA DNA repair protein and displays nuclear translocation in a cell cycle-dependent manner.
Sim DL, Yeo WM, Chow VT
The international journal of biochemistry & cell biology 2002 May;34(5):487-504
The international journal of biochemistry & cell biology 2002 May;34(5):487-504
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-SLC30A9 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate; SLC30A9 antibody - N-terminal region (AP42036PU-N) in Human HepG2 cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Liver; SLC30A9 antibody - N-terminal region (AP42036PU-N) in Human Liver cells using Immunohistochemistry