Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182374 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 30 (Zinc Transporter), Member 9 (SLC30A9) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC30A9 antibody: synthetic peptide directed towards the N terminal of human SLC30A9
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAI
NEFCL KSSDLEQLR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The novel human HUEL (C4orf1) protein shares homology with the DNA-binding domain of the XPA DNA repair protein and displays nuclear translocation in a cell cycle-dependent manner.
Sim DL, Yeo WM, Chow VT
The international journal of biochemistry & cell biology 2002 May;34(5):487-504
The international journal of biochemistry & cell biology 2002 May;34(5):487-504
No comments: Submit comment
No validations: Submit validation data