HPA004014

SLC30A9 antibody from Sigma-Aldrich
C4orf1, GAC63, HUEL, ZNT9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004014
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004014, RRID:AB_1080005
Product name
Anti-SLC30A9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004014
Antibody type
Polyclonal
Antigen
Solute carrier family 30 (zinc transporter), member 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFG
SFSNVVPCSHPYIGTLSQVKLYSTNVQKEGQGSQT
LRVEKVPSFETAEGIGAELKAPLKQEPLQVRVKAV
LKKREYGSKYTQNNFITGV
Storage
-20C
Provider Type Product Number
- No reagents -