HPA018304

G3BP2 antibody from Sigma-Aldrich
KIAA0660
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018304
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018304, RRID:AB_1849350
Product name
Anti-G3BP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018304
Antibody type
Polyclonal
Antigen
Ras GTPase-activating protein-binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQ
PSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEP
EPEPESETKTEELKPQVE
Storage
-20C
Provider Type Product Number
- No reagents -