HPA018304

G3BP2 antibody from Atlas Antibodies
KIAA0660
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018304
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018304, RRID:AB_1849350
Product name
Anti-G3BP2
Provider product page
Atlas Antibodies - HPA018304
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQ
PSPEPVQENANSGYYEAHPVTNGIEEPLEESSHEP
EPEPESETKTEELKPQVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -