Antibody data
- Product number
- HPA018425
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018425, RRID:AB_1849352
- Product name
- Anti-G3BP2
- Provider product page
- Atlas Antibodies - HPA018425
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPE
VQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQND
S
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Matrix stiffness drives epithelial–mesenchymal transition and tumour metastasis through a TWIST1–G3BP2 mechanotransduction pathway
Wei S, Fattet L, Tsai J, Guo Y, Pai V, Majeski H, Chen A, Sah R, Taylor S, Engler A, Yang J
Nature Cell Biology 2015 April;17(5):678-688
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in human cell line SH-SY5Y.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
55af80e3e0991
- Enhanced method
- Genetic validation
- Main image

- Experimental details
- Confocal images of immunofluorescently stained human U-2 OS cells.The protein G3BP2 is shown in green and the nucleus in blue. The image to the left show cells transfected with control siRNA and the image to the right show cells where G3BP2 has been downregulated with specific siRNA.
- Sample type
- U-2 OS cells
- Primary Ab dilution
- 1:70
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1:800
- Knockdown/Genetic Approaches Application
- Immunocytochemistry
- KD Reagent Type
- siRNA
- Downregulation
- >50%
- KD Reagent Provider
- Thermo Fisher Scientific
- KD Reagent Prod no
- s19206
- KD Reagent Prod page
- KD Reagent Prod page
- KD Reagent Prod no 2
- s19207
- KD Reagent Page 2
- KD Reagent Page 2
- KD Reagent Prod no 3
- s19208
- KD Reagent Page 3
- KD Reagent Page 3
- Antibody Lot Number
- R07917
- Appendix
- 55b73a7951716.pdf
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skin shows low expression as expected.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in molecular layer.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human skin shows very weak cytoplasmic positivity in epidermal cells.
- Sample type
- HUMAN
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and skin tissues using Anti-G3BP2 antibody. Corresponding G3BP2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image

- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and skin tissues using HPA018425 antibody. Corresponding G3BP2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
- Orthogonal method
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Show more
Supportive validation
- Submitted by
-
Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image

- Experimental details
- Immunohistochemical staining of human cerebellum, cerebral cortex, skin and testis using Anti-G3BP2 antibody HPA018425 (A) shows similar protein distribution across tissues to independent antibody HPA018304 (B).
- Antibody #2 product nr
- HPA018304
- Antibody provider
- Atlas Antibodies
- Show more