HPA019136

NUDCD3 antibody from Sigma-Aldrich
KIAA1068
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019136
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019136, RRID:AB_1852370
Product name
Anti-NUDCD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019136
Antibody type
Polyclonal
Antigen
NudC domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RRKEEEEAKTVSAAAAEKEPVPVPVQEIEIDSTTE
LDGHQEVEKVQPPGPVKEMAHGSQEAEAPGAVAGA
AE
Storage
-20C
Provider Type Product Number
- No reagents -