HPA019529

NUDCD3 antibody from Sigma-Aldrich
KIAA1068
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019529
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019529, RRID:AB_1852374
Product name
Anti-NUDCD3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019529
Antibody type
Polyclonal
Antigen
NudC domain-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NPDSYNGAVRENYTWSQDYTDLEVRVPVPKHVVKG
KQVSVALSSSSIRVAMLEENGERVLMEGKLTHKIN
TESSLWSL
Storage
-20C
Provider Type Product Number
- No reagents -