HPA007720

WDR20 antibody from MilliporeSigma / Merck KGaA
DMR, FLJ33659, MGC33177
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007720
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007720, RRID:AB_1080592
Product name
Anti-WDR20 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007720
Antibody type
Polyclonal
Antigen
WD repeat protein 20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGGKEMNEIKTQFTTREGLYKLLPHSEYSRPNRVP
FNSQGSNPVRVSFVNLNDQSGNGDRLCFNVGRELY
FYIYKGVRKAADLSKPIDKRIYKGTQPTCHDFNHL
TATAESVSLLVGF
Storage
-20C
Provider Type Product Number
- No reagents -