HPA004714

CACNA1G antibody from Sigma-Aldrich
Cav3.1, NBR13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004714
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004714, RRID:AB_1078368
Product name
Anti-CACNA1G antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004714
Antibody type
Polyclonal
Antigen
Voltage-dependent T-type calcium channel subunit alpha-1G recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KEKALVEVAASSGPPTLTSLNIPPGPYSSMHKLLE
TQSTGACQSSCKISSPCLKADSGACGPDSCPYCAR
AGAGEVELADREMPDSDSEAVYEFTQDAQHSDLRD
PHSRRQRSLGPDAEPS
Storage
-20C
Provider Type Product Number
- No reagents -