HPA018105

NPC1L1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018105
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018105, RRID:AB_1854581
Product name
Anti-NPC1L1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018105
Antibody type
Polyclonal
Antigen
Niemann-Pick C1-like protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CSDNFVNLHCHNTCSPNQSLFINVTRVAQLGAGQL
PAVVAYEAFYQHSFAEQSYDSCSRVRVPAAATLAV
GTMCGVYGSALCNAQRWLNFQGDTGNGLAPLDITF
HLLEPGQAVGSGIQPLNEGVARCNESQGDDVATCS
CQDCAAS
Storage
-20C
Provider Type Product Number
- No reagents -