HPA023973

EIF3E antibody from Atlas Antibodies
eIF3-p48, eIF3e, EIF3S6, INT6
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA023973
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023973, RRID:AB_1848083
Product name
Anti-EIF3E
Provider product page
Atlas Antibodies - HPA023973
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ARLFIFETFCRIHQCISINMLADKLNMTPEEAERW
IVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVI
EKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQ
DSGFY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -