ABIN405974

EIF3E antibody from antibodies-online
eIF3-p48, eIF3e, EIF3S6, INT6

Antibody data

Product number
ABIN405974
Provider
antibodies-online
Product name
anti-Eukaryotic Translation Initiation Factor 3 Subunit E (EIF3E) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405974
Antibody type
Polyclonal
Antigen
The immunogen for anti-EIF3E antibody: synthetic peptide directed towards the middle region of human EIF3E
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMG
NNAVS PYQQVIEKTK
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -