HPA023973

EIF3E antibody from Sigma-Aldrich
eIF3-p48, eIF3e, EIF3S6, INT6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023973
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023973, RRID:AB_1848083
Product name
Anti-EIF3E antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023973
Antibody type
Polyclonal
Antigen
Eukaryotic translation initiation factor 3 subunit E recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ARLFIFETFCRIHQCISINMLADKLNMTPEEAERW
IVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVI
EKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQ
DSGFY
Storage
-20C
Provider Type Product Number
- No reagents -