HPA066185

DNASE2 antibody from Atlas Antibodies
DNL, DNL2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA066185
Provider
Atlas Antibodies
Product name
Anti-DNASE2
Provider product page
Atlas Antibodies - HPA066185
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCV
SPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWK
AFQPLVKNYQPCNGMARKPSR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -